Skip to Content
Price List Default - EUR
  1. All Products
  2. Recombinant Human Uncharacterized protein C1orf54 (C1orf54), E.coli expression - 20 ug
Recombinant Human Uncharacterized protein C1orf54 (C1orf54), E.coli expression - 20 ug

Recombinant Human Uncharacterized protein C1orf54 (C1orf54), E.coli expression - 20 ug

https://www.gentaur.be/web/image/product.template/19480/image_1920?unique=325b45d
(0 review)

Uniprot No: Q8WWF1
Expression Region: 17-131aa (Full Length of Mature Protein)
Tag: C-terminal 6xHis-tag

0.00 € 0.0 EUR 0.00 € Tax Excluded

info@gentaur.com

    This combination does not exist.

    Contact Us For The Price

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days

    Share

    Internal Reference: 0399-CSB-EP840992HUc7-20UG
    Website URL: /shop/0399-csb-ep840992huc7-20ug-recombinant-human-uncharacterized-protein-c1orf54-c1orf54-e-coli-expression-20-ug-19480

    Uniprot No: Q8WWF1

    Expression Region: 17-131aa (Full Length of Mature Protein)

    Tag: C-terminal 6xHis-tag

    Protein Sequence: QEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM

    Votre snippet dynamique sera affiché ici... Ce message est affiché parce que vous n'avez pas défini le filtre et le modèle à utiliser.