Skip to Content

Custom Mouse anti-Human TRDV3 Monoclonal Antibody, Biotin Conjugated - 5 mg

https://www.gentaur.be/web/image/product.template/19076/image_1920?unique=325b45d
(0 review)

Antigen Uniprot ID: A0JD37

Antigen Sequences:
DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVIS
PVRTEDSATYYCAF

Guaranteed Deliverables:
1. 200ug * antigen (used as positive control);
2. 25ul * Pre-immune serum (used as negative control);
3. 100ul mouse ascites fluid;
4. 5mg * Biotin conjugated monoclonal antibodies purified by Protein A/G;

Guaranteed Quality:
1. Titer of immune serum can be guaranteed 1: 10000 through in-direct ELISA before purification.
2. Antibody purity can be guaranteed above 90% by SDS-PAGE detection.
3. Antibody can be guaranteed to specifically recognize antigen through western blot assay (not available if antigen is peptide).

Lead time: ~24-32 weeks

0.00 € 0.0 EUR 0.00 € Tax Excluded

info@gentaur.com

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days


    Internal Reference: 0399-CSB-MA4341XD05MO
    Website URL: /shop/0399-csb-ma4341xd05mo-custom-mouse-anti-human-trdv3-monoclonal-antibody-biotin-conjugated-5-mg-19076

    Votre snippet dynamique sera affiché ici... Ce message est affiché parce que vous n'avez pas défini le filtre et le modèle à utiliser.