Antigen Uniprot ID: A0JD37

Antigen Sequences:
DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVIS
PVRTEDSATYYCAF

Guaranteed Deliverables:
1. 200ug * antigen (used as positive control);
2. 25ul * Pre-immune serum (used as negative control);
3. 100ul mouse ascites fluid;
4. 5mg * FITC conjugated monoclonal antibodies purified by Protein A/G;

Guaranteed Quality:
1. Titer of immune serum can be guaranteed 1: 10000 through in-direct ELISA before purification.
2. Antibody purity can be guaranteed above 90% by SDS-PAGE detection.
3. Antibody can be guaranteed to specifically recognize antigen through western blot assay (not available if antigen is peptide).

Lead time: ~24-32 weeks

DNA extraction kit is not included.

DNA extraction kit is not included.

Isotype: lgE
Species: Mouse
Source: Tissue culture
Purification method: None

Kit contents:
1X Basal Medium (250mL)
1X Growth Supplement Mix (5ml)

Assay type: Qualitative Sandwich Lateral Flow
Sensitivity: 98.3%
Specificity: 99.3%
Assay time: 10 minutes
Sample types: Trachea and Cloacal orifice secretions

Assay type: Qualitative Sandwich Lateral Flow
Sensitivity: 98.7%
Specificity: 99.7%
Assay time: 10 minutes
Sample types: Trachea and Cloacal orifice secretions

Assay type: Qualitative Sandwich Lateral Flow
Sensitivity: 98.3%
Specificity: 99.3%
Assay time: 10 minutes
Sample types: Trachea and Cloacal orifice secretions

Benzaldehyde-Polyethylene glycol-Thiol

Assay type: Competitive inhibition
Sensitivity: 0.1 PPB (parts per billion)
Sample types: serum, plasma, tissue homogenates and other biological fluids