Хypothetical protein WP_003477458 459bp pUC vector - 100ug plasmid + 200ul glycerol

https://www.gentaur.be/web/image/product.template/5440/image_1920?unique=8f28d63
(0 avis)

415,00 € 415.0 EUR 415,00 € hors TVA

415,00 € hors TVA

Not Available For Sale

    Cette combinaison n'existe pas.

    Conditions générales
    Garantie satisfait ou remboursé de 30 jours
    Expédition : 2-3 jours ouvrables

    DNA Sequence:

    RC48GOI: atgagtccatattatagatataaaaaagaaaaatttttagaaaagtatcaatcagcaactgataacttagaagatttaaaagtagcaataaaagaatataaagatactaataatagaattataagaagagctatgtttgctttctttcaagatttcactgaatatattattgatatgtgtgaaagttatatattgataaatgatgggaaaataaagagtacaacttctgcaacacagctagttgaacaagcatatgatatgggcttttttgataatgaactaaaaaaatacttagttttatcagtgaaacttagaaatagatatactcatgattattacctaagagaagagagcgaaaaagcaatagaagaattctgttttttaaaactagcaaatctagaaatatttttagaagaaagtaaggataaagttattcttaaatataaaaatttagtttaaMSPYYRYKKE

    Protein sequence:

    KFLEKYQSATDNLEDLKVAIKEYKDTNNRIIRRAMFAFFQDFTEYIIDMC
    ESYILINDGKIKSTTSATQLVEQAYDMGFFDNELKKYLVLSVKLRNRYTHDYYLREESEKAIEEFCFLKLANLEIFLEESKDKVILKYKNLV