Recombinant SARS-CoV-2 Pirola variant Spike glycoprotein (S), partial, E.coli expression, tag-free - 1 mg

https://www.gentaur.be/web/image/product.template/8181/image_1920?unique=355a290
(0 avis)

1 846,00 € 1846.0 EUR 1 846,00 € hors TVA

1 846,00 € hors TVA

Not Available For Sale

    Cette combinaison n'existe pas.

    Conditions générales
    Garantie satisfait ou remboursé de 30 jours
    Expédition : 2-3 jours ouvrables

    Type: Recombinant protein

    Expression system: E. coli

    Species: SARS-CoV-2, Pirola variant

    Tag: None

    Expression Region: 315-535 aa

    Target Protein Sequence (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):

    TSNFRVQPTESIVRFPNVTNLCPFHEVFNATRFASVYAWNRTRISNCVADYSVLYNLAPFFTFKCYGVSPTKLNDLCFTNVYADSFVIKGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKHSGNYDYMYRLFRKSKLKPFERDISTEIYQAGNKPCKGKGPNCYFPLQSYSFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVK