gene-30526.1 Recombinant Protein expressed in E.coli - 1 mg

https://www.gentaur.be/web/image/product.template/9549/image_1920?unique=6809a1a
(0 avis)

1 574,00 € 1574.0 EUR 1 574,00 € hors TVA

1 574,00 € hors TVA

Not Available For Sale

    Cette combinaison n'existe pas.

    Conditions générales
    Garantie satisfait ou remboursé de 30 jours
    Expédition : 2-3 jours ouvrables

    Expression System: E. coli

    Expression Region: Expression Region: 1-202aa;Full Length

    Tag Information: N-terminal His Tag


    Target Protein Sequence

    (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):

    METAGTTPPSKRRLTSKTSSFRLRCDSLNTLRLRR

    IFDLFDKNNDGFITVDELSSALNLLGLETDRSELE

    FTIISFIQPGNKGLRFEDFISLHQSLDETYFVCDDH

    IVNHVGAEEDQKMNNHQTMSQEDSDLSEAFK

    VFDEDGDGYISAKELQIVLGKLGFSEGNEIGRVEK

    MIFSVDRNQDGRVDFFEFKDMMRGVLVRSS