gene-31556.1 Recombinant Protein expressed in E.coli - 1 mg

https://www.gentaur.be/web/image/product.template/9554/image_1920?unique=9c952b0

1 670,00 € 1670.0 EUR 1 670,00 €

1 670,00 €

Not Available For Sale

    Cette combinaison n'existe pas.

    Conditions générales
    Garantie satisfait ou remboursé de 30 jours
    Expédition : 2-3 jours ouvrables

    Expression System: E. coli

    Expression Region: Expression Region: 1-238 aa;Full Length

    Tag Information: N-terminal His Tag


    Target Protein Sequence

    (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):

    MAAATVNEQLPTPLDATSEPPPLFDGTTRLYISLS

    CPYAQRTWITRNYKGLYDKIKVVPINLQNRPAW

    YKEKVYPENKVPSLEHNGKVIGESLDLIKYIDSNF

    EGPSLLPNDHAKKQFAEDLIAYTDTFNKTVYTSF

    KGDTVKEAGPAFDHLENALSKFEDGPFFLGHEFS

    LADVAYIPFVERFQIVFSALWNYDITAGRPKLAK

    WIEEVNKIDAYKPTKTDPKELVEFYKARFLVQK