Custom Mouse anti-Human TRDV3 Monoclonal Antibody, Biotin Conjugated - 5 mg
Antigen Uniprot ID: A0JD37
Antigen Sequences:
DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVIS
PVRTEDSATYYCAF
Guaranteed Deliverables:
1. 200ug * antigen (used as positive control);
2. 25ul * Pre-immune serum (used as negative control);
3. 100ul mouse ascites fluid;
4. 5mg * Biotin conjugated monoclonal antibodies purified by Protein A/G;
Guaranteed Quality:
1. Titer of immune serum can be guaranteed 1: 10000 through in-direct ELISA before purification.
2. Antibody purity can be guaranteed above 90% by SDS-PAGE detection.
3. Antibody can be guaranteed to specifically recognize antigen through western blot assay (not available if antigen is peptide).
Lead time: ~24-32 weeks
Référence interne:
0399-CSB-MA4341XD05MO
URL du site web:
/shop/0399-csb-ma4341xd05mo-custom-mouse-anti-human-trdv3-monoclonal-antibody-biotin-conjugated-5-mg-19076